PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400020565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 189aa    MW: 20642.6 Da    PI: 10.9172
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400020565genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.45.2e-20105139135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  PGSC0003DMP400020565 105 CQHCGADKTPQWRAGPLGPKTLCNACGVRYKSGRL 139
                           *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.13699135IPR000679Zinc finger, GATA-type
SMARTSM004018.8E-1699149IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.76E-15101162No hitNo description
Gene3DG3DSA:3.30.50.105.6E-15102137IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.63E-14104152No hitNo description
PROSITE patternPS003440105130IPR000679Zinc finger, GATA-type
PfamPF003201.3E-17105139IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MVFDHHSPVS VLENSSSTSH SSGNGVVNGN AYTSCCVNLK VPVNYPVRAR SKRRRRRRRG  60
GFANMPSEHC LPVTQPSFKN VKQHEPLLSL PMNSAKSAAS IGRRCQHCGA DKTPQWRAGP  120
LGPKTLCNAC GVRYKSGRLL PEYRPANSPS FSAAAHSNSH RKVLEMRKHK IGVGGMLIHE  180
ACGYRVEQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14958RSKRRRRRRR
25156KRRRRR
35258RRRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340920.11e-137PREDICTED: GATA transcription factor 1-like
TrEMBLM1ATZ41e-138M1ATZ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000302741e-138(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.11e-41GATA transcription factor 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]